PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00087312001
Common NameGSBRNA2T00087312001, LOC106435356
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 430aa    MW: 47182.6 Da    PI: 8.9138
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00087312001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-39105165262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt+GG++rnvPvG+grrk+k+ss
  GSBRNA2T00087312001 105 PTKILPCPRCKSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVPVGAGRRKHKSSS 165
                          67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2881157IPR003851Zinc finger, Dof-type
PfamPF027016.2E-32107163IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.435109163IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MMMESRDPAI KLFGMKIPFP AVFEPTTAVT LEEDYSGGDD KSPEKVTTEQ ATPEKKNNCN  60
NKSLNNSNDS KPETGDKEEA TSTDQIESDE TNQQTTADGK TLKKPTKILP CPRCKSMDTK  120
FCYYNNYNIN QPRHFCKACQ RYWTAGGTMR NVPVGAGRRK HKSSSSHYRH ITISEALQAA  180
RLDPGLQSNT RVLSFGLQAP PHQQHVAPMT PVMKLQGDQK VSNGARNGLA ARVENGDDCS  240
SGSSVTTSVD ETRAQSCRVV EPQVNNNMNG YACIPGVPWP YTWNPAMPQP GFYPPPGYPM  300
PFYPYWTIPM APPNQSSSPM SQKGSSSNSP TLGKHSRDED SSTERKQRNG CVIVPKTLRI  360
DDPNEAAKSS IWTTLGIKNE GSTLGSKGGM FKGFDQKTNK SNKDQTDNSP VRSANPAALS  420
RSLNFQERV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.46210.0flower| leaf| root| seed| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU4513120.0GU451312.1 Brassica napus putative dof zinc finger protein (dof1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013731682.10.0PREDICTED: cyclic dof factor 3-like
SwissprotQ8LFV30.0CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A078I8Z10.0A0A078I8Z1_BRANA; BnaCnng15140D protein
STRINGBra018141.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54412848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.10.0cycling DOF factor 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]